Hi Katharina,
Thanks for your prompt reply! Here is the whole content in the aaa.gff.
# This output was generated with AUGUSTUS (version 3.2.1).
# AUGUSTUS is a gene prediction tool written by M. Stanke (
mario.stanke@uni-greifswald.de),
# O. Keller, S. König, L. Gerischer and L. Romoth.
# Please cite: Mario Stanke, Mark Diekhans, Robert Baertsch, David Haussler (2008),
# Using native and syntenically mapped cDNA alignments to improve de novo gene finding
# Bioinformatics 24: 637-644, doi 10.1093/bioinformatics/btn013
# No extrinsic information on sequences given.
# Initialising the parameters using config directory /home/lgh/ngs/augustus-3.2.1/config/ ...
# nasonia version. Using default transition matrix.
# Looks like aaa.fa is in fasta format.
# We have hints for 0 sequences and for 0 of the sequences in the input set.
#
# ----- prediction on sequence number 1 (length = 1002, name = C8001580) -----
#
# Constraints/Hints:
# (none)
# Predicted genes for sequence number 1 on both strands
# start gene g1
C8001580 AUGUSTUS gene 1 591 0.89 + . g1
C8001580 AUGUSTUS transcript 1 591 0.89 + . g1.t1
C8001580 AUGUSTUS intron 1 46 0.89 + . transcript_id "g1.t1"; gene_id "g1";
C8001580 AUGUSTUS intron 175 244 0.92 + . transcript_id "g1.t1"; gene_id "g1";
C8001580 AUGUSTUS CDS 47 174 0.89 + 1 transcript_id "g1.t1"; gene_id "g1";
C8001580 AUGUSTUS CDS 245 591 0.92 + 2 transcript_id "g1.t1"; gene_id "g1";
C8001580 AUGUSTUS stop_codon 589 591 . + 0 transcript_id "g1.t1"; gene_id "g1";
# coding sequence = [tcttaatgctgtcaatatggcttggtgtagtttagatactgagactatgacattactttgtaaatctttgcctccgtcc
# gttacgcgtttaaatatagctggatgcagaaaaactatgacagatgataatgttaaagatttagtaaaaagttgtccagatataatagaattagattt
# gagtgattgtactatgcttacaatgaatactgttcgtagtttacttgatttatcaaaattagaacatttgtcgttaagtcgttgttatggtatacctc
# cttcaacatatgtaacattggcatatatgccatctttgctatatttggatgtttttggtgtaatacctgaaccagtactaaaaacattacaagttacc
# tgtggtgaaactcaacttaataaatatctatatagttctgttgcaagaccaacagttggtgttcgaagaacaagtatttggggacttcgtgttagaga
# ttga]
# protein sequence = [LNAVNMAWCSLDTETMTLLCKSLPPSVTRLNIAGCRKTMTDDNVKDLVKSCPDIIELDLSDCTMLTMNTVRSLLDLSK
# LEHLSLSRCYGIPPSTYVTLAYMPSLLYLDVFGVIPEPVLKTLQVTCGETQLNKYLYSSVARPTVGVRRTSIWGLRVRD]
# end gene g1
###
# command line:
# augustus --strand=both --species=nasonia aaa.fa --outfile=aaa.gff --codingseq=on --protein=on